KREMEN1 monoclonal antibody (M01), clone 1E7 View larger

KREMEN1 monoclonal antibody (M01), clone 1E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KREMEN1 monoclonal antibody (M01), clone 1E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about KREMEN1 monoclonal antibody (M01), clone 1E7

Brand: Abnova
Reference: H00083999-M01
Product name: KREMEN1 monoclonal antibody (M01), clone 1E7
Product description: Mouse monoclonal antibody raised against a partial recombinant KREMEN1.
Clone: 1E7
Isotype: IgG2a Kappa
Gene id: 83999
Gene name: KREMEN1
Gene alias: FLJ31863|KREMEM1|KREMEN|KRM1
Gene description: kringle containing transmembrane protein 1
Genbank accession: NM_032045
Immunogen: KREMEN1 (NP_114434, 310 a.a. ~ 391 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
Protein accession: NP_114434
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083999-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083999-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged KREMEN1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KREMEN1 monoclonal antibody (M01), clone 1E7 now

Add to cart