TSSK6 monoclonal antibody (M02A), clone 6F5 View larger

TSSK6 monoclonal antibody (M02A), clone 6F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSSK6 monoclonal antibody (M02A), clone 6F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about TSSK6 monoclonal antibody (M02A), clone 6F5

Brand: Abnova
Reference: H00083983-M02A
Product name: TSSK6 monoclonal antibody (M02A), clone 6F5
Product description: Mouse monoclonal antibody raised against a partial recombinant TSSK6.
Clone: 6F5
Isotype: IgG2a Kappa
Gene id: 83983
Gene name: TSSK6
Gene alias: FLJ24002|SSTK|TSSK4
Gene description: testis-specific serine kinase 6
Genbank accession: BC014611
Immunogen: TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Protein accession: AAH14611
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083983-M02A-1-25-1.jpg
Application image note: TSSK6 monoclonal antibody (M02A), clone 6F5 Western Blot analysis of TSSK6 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy TSSK6 monoclonal antibody (M02A), clone 6F5 now

Add to cart