Brand: | Abnova |
Reference: | H00083983-D01 |
Product name: | TSSK6 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human TSSK6 protein. |
Gene id: | 83983 |
Gene name: | TSSK6 |
Gene alias: | FLJ24002|SSTK|TSSK4 |
Gene description: | testis-specific serine kinase 6 |
Genbank accession: | NM_032037.2 |
Immunogen: | TSSK6 (NP_114426.1, 1 a.a. ~ 273 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG |
Protein accession: | NP_114426.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TSSK6 MaxPab rabbit polyclonal antibody. Western Blot analysis of TSSK6 expression in human colon. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |