TSSK6 MaxPab mouse polyclonal antibody (B01) View larger

TSSK6 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSSK6 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about TSSK6 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00083983-B01
Product name: TSSK6 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human TSSK6 protein.
Gene id: 83983
Gene name: TSSK6
Gene alias: FLJ24002|SSTK|TSSK4
Gene description: testis-specific serine kinase 6
Genbank accession: NM_032037.2
Immunogen: TSSK6 (NP_114426.1, 1 a.a. ~ 273 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Protein accession: NP_114426.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083983-B01-2-A4-1.jpg
Application image note: TSSK6 MaxPab polyclonal antibody. Western Blot analysis of TSSK6 expression in human spleen.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TSSK6 MaxPab mouse polyclonal antibody (B01) now

Add to cart