TSSK1B monoclonal antibody (M02), clone 2E8 View larger

TSSK1B monoclonal antibody (M02), clone 2E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSSK1B monoclonal antibody (M02), clone 2E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about TSSK1B monoclonal antibody (M02), clone 2E8

Brand: Abnova
Reference: H00083942-M02
Product name: TSSK1B monoclonal antibody (M02), clone 2E8
Product description: Mouse monoclonal antibody raised against a partial recombinant TSSK1B.
Clone: 2E8
Isotype: IgG2b Kappa
Gene id: 83942
Gene name: TSSK1B
Gene alias: FKSG81|SPOGA4|STK22D|TSSK1
Gene description: testis-specific serine kinase 1B
Genbank accession: BC022515
Immunogen: TSSK1B (AAH22515, 267 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ
Protein accession: AAH22515
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083942-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00083942-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TSSK1B on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSSK1B monoclonal antibody (M02), clone 2E8 now

Add to cart