TSSK1B monoclonal antibody (M01), clone 4F12 View larger

TSSK1B monoclonal antibody (M01), clone 4F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSSK1B monoclonal antibody (M01), clone 4F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TSSK1B monoclonal antibody (M01), clone 4F12

Brand: Abnova
Reference: H00083942-M01
Product name: TSSK1B monoclonal antibody (M01), clone 4F12
Product description: Mouse monoclonal antibody raised against a partial recombinant TSSK1B.
Clone: 4F12
Isotype: IgG1 Kappa
Gene id: 83942
Gene name: TSSK1B
Gene alias: FKSG81|SPOGA4|STK22D|TSSK1
Gene description: testis-specific serine kinase 1B
Genbank accession: BC022515
Immunogen: TSSK1B (AAH22515, 267 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LSHCWMQPKARGSPSVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETRAQ
Protein accession: AAH22515
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083942-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083942-M01-13-15-1.jpg
Application image note: Western Blot analysis of TSSK1B expression in transfected 293T cell line by TSSK1B monoclonal antibody (M01), clone 4F12.

Lane 1: TSSK1B transfected lysate(41.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Expression and Localization of Five Members of the Testis-Specific Serine Kinase (Tssk) Family in Mouse and Human Sperm and Testis.Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM.
Mol Hum Reprod. 2011 Jan;17(1):42-56. Epub 2010 Aug 20.

Reviews

Buy TSSK1B monoclonal antibody (M01), clone 4F12 now

Add to cart