STK40 monoclonal antibody (M04), clone 4G3 View larger

STK40 monoclonal antibody (M04), clone 4G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STK40 monoclonal antibody (M04), clone 4G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re

More info about STK40 monoclonal antibody (M04), clone 4G3

Brand: Abnova
Reference: H00083931-M04
Product name: STK40 monoclonal antibody (M04), clone 4G3
Product description: Mouse monoclonal antibody raised against a partial recombinant STK40.
Clone: 4G3
Isotype: IgG2a Kappa
Gene id: 83931
Gene name: STK40
Gene alias: MGC4796|RP11-268J15.4|SHIK|SgK495
Gene description: serine/threonine kinase 40
Genbank accession: NM_032017
Immunogen: STK40 (NP_114406, 349 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR
Protein accession: NP_114406
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083931-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083931-M04-3-38-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy STK40 monoclonal antibody (M04), clone 4G3 now

Add to cart