SNX25 monoclonal antibody (M01), clone 3A8 View larger

SNX25 monoclonal antibody (M01), clone 3A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX25 monoclonal antibody (M01), clone 3A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SNX25 monoclonal antibody (M01), clone 3A8

Brand: Abnova
Reference: H00083891-M01
Product name: SNX25 monoclonal antibody (M01), clone 3A8
Product description: Mouse monoclonal antibody raised against a full length recombinant SNX25.
Clone: 3A8
Isotype: IgG1 kappa
Gene id: 83891
Gene name: SNX25
Gene alias: FLJ23161|MSTP043|SBBI31
Gene description: sorting nexin 25
Genbank accession: BC029868
Immunogen: SNX25 (AAH29868, 1 a.a. ~ 483 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV
Protein accession: AAH29868
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083891-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (78.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083891-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SNX25 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNX25 monoclonal antibody (M01), clone 3A8 now

Add to cart