SNX25 purified MaxPab mouse polyclonal antibody (B01P) View larger

SNX25 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX25 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SNX25 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00083891-B01P
Product name: SNX25 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SNX25 protein.
Gene id: 83891
Gene name: SNX25
Gene alias: FLJ23161|MSTP043|SBBI31
Gene description: sorting nexin 25
Genbank accession: ENST00000296779
Immunogen: SNX25 (ENSP00000296779, 1 a.a. ~ 483 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV
Protein accession: ENSP00000296779
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083891-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SNX25 expression in transfected 293T cell line (H00083891-T01) by SNX25 MaxPab polyclonal antibody.

Lane 1: SNX25 transfected lysate(53.13 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNX25 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart