MIXL1 monoclonal antibody (M02), clone 4D11 View larger

MIXL1 monoclonal antibody (M02), clone 4D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MIXL1 monoclonal antibody (M02), clone 4D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MIXL1 monoclonal antibody (M02), clone 4D11

Brand: Abnova
Reference: H00083881-M02
Product name: MIXL1 monoclonal antibody (M02), clone 4D11
Product description: Mouse monoclonal antibody raised against a partial recombinant MIXL1.
Clone: 4D11
Isotype: IgG2a Kappa
Gene id: 83881
Gene name: MIXL1
Gene alias: MGC138179|MILD1|MIX|MIXL
Gene description: Mix1 homeobox-like 1 (Xenopus laevis)
Genbank accession: NM_031944
Immunogen: MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP
Protein accession: NP_114150
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083881-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MIXL1 monoclonal antibody (M02), clone 4D11 now

Add to cart