RAB34 monoclonal antibody (M06), clone 3A5 View larger

RAB34 monoclonal antibody (M06), clone 3A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB34 monoclonal antibody (M06), clone 3A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RAB34 monoclonal antibody (M06), clone 3A5

Brand: Abnova
Reference: H00083871-M06
Product name: RAB34 monoclonal antibody (M06), clone 3A5
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB34.
Clone: 3A5
Isotype: IgG2a Kappa
Gene id: 83871
Gene name: RAB34
Gene alias: RAB39|RAH
Gene description: RAB34, member RAS oncogene family
Genbank accession: NM_031934
Immunogen: RAB34 (NP_114140.2, 170 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
Protein accession: NP_114140.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083871-M06-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB34 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RAB34 monoclonal antibody (M06), clone 3A5 now

Add to cart