Brand: | Abnova |
Reference: | H00083871-M06 |
Product name: | RAB34 monoclonal antibody (M06), clone 3A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB34. |
Clone: | 3A5 |
Isotype: | IgG2a Kappa |
Gene id: | 83871 |
Gene name: | RAB34 |
Gene alias: | RAB39|RAH |
Gene description: | RAB34, member RAS oncogene family |
Genbank accession: | NM_031934 |
Immunogen: | RAB34 (NP_114140.2, 170 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP |
Protein accession: | NP_114140.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RAB34 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |