KLF16 purified MaxPab mouse polyclonal antibody (B01P) View larger

KLF16 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLF16 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about KLF16 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00083855-B01P
Product name: KLF16 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human KLF16 protein.
Gene id: 83855
Gene name: KLF16
Gene alias: BTEB4|DRRF|NSLP2
Gene description: Kruppel-like factor 16
Genbank accession: BC148793
Immunogen: KLF16 (AAI48794.1, 1 a.a. ~ 252 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGPGAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYKSSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAPAGL
Protein accession: AAI48794.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083855-B01P-13-15-1.jpg
Application image note: Western Blot analysis of KLF16 expression in transfected 293T cell line (H00083855-T01) by KLF16 MaxPab polyclonal antibody.

Lane 1: KLF16 transfected lysate(27.72 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KLF16 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart