ANGPTL6 monoclonal antibody (M01), clone 1A11 View larger

ANGPTL6 monoclonal antibody (M01), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL6 monoclonal antibody (M01), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ANGPTL6 monoclonal antibody (M01), clone 1A11

Brand: Abnova
Reference: H00083854-M01
Product name: ANGPTL6 monoclonal antibody (M01), clone 1A11
Product description: Mouse monoclonal antibody raised against a partial recombinant ANGPTL6.
Clone: 1A11
Isotype: IgG2a Kappa
Gene id: 83854
Gene name: ANGPTL6
Gene alias: AGF|ARP5
Gene description: angiopoietin-like 6
Genbank accession: NM_031917
Immunogen: ANGPTL6 (NP_114123, 211 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI
Protein accession: NP_114123
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083854-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083854-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ANGPTL6 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ANGPTL6 monoclonal antibody (M01), clone 1A11 now

Add to cart