SETDB2 monoclonal antibody (M22A), clone 1H3 View larger

SETDB2 monoclonal antibody (M22A), clone 1H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SETDB2 monoclonal antibody (M22A), clone 1H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about SETDB2 monoclonal antibody (M22A), clone 1H3

Brand: Abnova
Reference: H00083852-M22A
Product name: SETDB2 monoclonal antibody (M22A), clone 1H3
Product description: Mouse monoclonal antibody raised against a partial recombinant SETDB2.
Clone: 1H3
Isotype: IgG2a Kappa
Gene id: 83852
Gene name: SETDB2
Gene alias: C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F
Gene description: SET domain, bifurcated 2
Genbank accession: NM_031915
Immunogen: SETDB2 (NP_114121.1, 620 a.a. ~ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
Protein accession: NP_114121.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy SETDB2 monoclonal antibody (M22A), clone 1H3 now

Add to cart