Brand: | Abnova |
Reference: | H00083852-M17 |
Product name: | SETDB2 monoclonal antibody (M17), clone 2F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SETDB2. |
Clone: | 2F4 |
Isotype: | IgG2a Kappa |
Gene id: | 83852 |
Gene name: | SETDB2 |
Gene alias: | C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F |
Gene description: | SET domain, bifurcated 2 |
Genbank accession: | NM_031915 |
Immunogen: | SETDB2 (NP_114121.1, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED |
Protein accession: | NP_114121.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SETDB2 monoclonal antibody (M17), clone 2F4. Western Blot analysis of SETDB2 expression in A-431(Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | SETDB2 Links E2A-PBX1 to Cell-Cycle Dysregulation in Acute Leukemia through CDKN2C Repression.Lin CH, Wong SH, Kurzer JH, Schneidawind C, Wei MC, Duque-Afonso J, Jeong J, Feng X, Cleary ML. Cell Rep. 2018 Apr 24;23(4):1166-1177. |