SETDB2 monoclonal antibody (M17), clone 2F4 View larger

SETDB2 monoclonal antibody (M17), clone 2F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SETDB2 monoclonal antibody (M17), clone 2F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SETDB2 monoclonal antibody (M17), clone 2F4

Brand: Abnova
Reference: H00083852-M17
Product name: SETDB2 monoclonal antibody (M17), clone 2F4
Product description: Mouse monoclonal antibody raised against a partial recombinant SETDB2.
Clone: 2F4
Isotype: IgG2a Kappa
Gene id: 83852
Gene name: SETDB2
Gene alias: C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F
Gene description: SET domain, bifurcated 2
Genbank accession: NM_031915
Immunogen: SETDB2 (NP_114121.1, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED
Protein accession: NP_114121.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083852-M17-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083852-M17-1-4-1.jpg
Application image note: SETDB2 monoclonal antibody (M17), clone 2F4. Western Blot analysis of SETDB2 expression in A-431(Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: SETDB2 Links E2A-PBX1 to Cell-Cycle Dysregulation in Acute Leukemia through CDKN2C Repression.Lin CH, Wong SH, Kurzer JH, Schneidawind C, Wei MC, Duque-Afonso J, Jeong J, Feng X, Cleary ML.
Cell Rep. 2018 Apr 24;23(4):1166-1177.

Reviews

Buy SETDB2 monoclonal antibody (M17), clone 2F4 now

Add to cart