H00083852-M07A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA |
Brand: | Abnova |
Reference: | H00083852-M07A |
Product name: | SETDB2 monoclonal antibody (M07A), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SETDB2. |
Clone: | 1E2 |
Isotype: | IgG2a Kappa |
Gene id: | 83852 |
Gene name: | SETDB2 |
Gene alias: | C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F |
Gene description: | SET domain, bifurcated 2 |
Genbank accession: | NM_031915 |
Immunogen: | SETDB2 (NP_114121.1, 620 a.a. ~ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL |
Protein accession: | NP_114121.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SETDB2 monoclonal antibody (M07A), clone 1E2. Western Blot analysis of SETDB2 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |