SETDB2 monoclonal antibody (M07), clone 1E2 View larger

SETDB2 monoclonal antibody (M07), clone 1E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SETDB2 monoclonal antibody (M07), clone 1E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about SETDB2 monoclonal antibody (M07), clone 1E2

Brand: Abnova
Reference: H00083852-M07
Product name: SETDB2 monoclonal antibody (M07), clone 1E2
Product description: Mouse monoclonal antibody raised against a partial recombinant SETDB2.
Clone: 1E2
Isotype: IgG2a Kappa
Gene id: 83852
Gene name: SETDB2
Gene alias: C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F
Gene description: SET domain, bifurcated 2
Genbank accession: NM_031915
Immunogen: SETDB2 (NP_114121.1, 620 a.a. ~ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
Protein accession: NP_114121.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083852-M07-1-22-1.jpg
Application image note: SETDB2 monoclonal antibody (M07), clone 1E2. Western Blot analysis of SETDB2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SETDB2 monoclonal antibody (M07), clone 1E2 now

Add to cart