Brand: | Abnova |
Reference: | H00083844-M01 |
Product name: | USP26 monoclonal antibody (M01), clone 4G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP26. |
Clone: | 4G8 |
Isotype: | IgG2a Kappa |
Gene id: | 83844 |
Gene name: | USP26 |
Gene alias: | MGC120066|MGC120067|MGC120068 |
Gene description: | ubiquitin specific peptidase 26 |
Genbank accession: | NM_031907 |
Immunogen: | USP26 (NP_112223, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPV |
Protein accession: | NP_112223 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |