USP26 monoclonal antibody (M01), clone 4G8 View larger

USP26 monoclonal antibody (M01), clone 4G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP26 monoclonal antibody (M01), clone 4G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about USP26 monoclonal antibody (M01), clone 4G8

Brand: Abnova
Reference: H00083844-M01
Product name: USP26 monoclonal antibody (M01), clone 4G8
Product description: Mouse monoclonal antibody raised against a partial recombinant USP26.
Clone: 4G8
Isotype: IgG2a Kappa
Gene id: 83844
Gene name: USP26
Gene alias: MGC120066|MGC120067|MGC120068
Gene description: ubiquitin specific peptidase 26
Genbank accession: NM_031907
Immunogen: USP26 (NP_112223, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPV
Protein accession: NP_112223
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy USP26 monoclonal antibody (M01), clone 4G8 now

Add to cart