RBP5 monoclonal antibody (M05), clone 2D1 View larger

RBP5 monoclonal antibody (M05), clone 2D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBP5 monoclonal antibody (M05), clone 2D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about RBP5 monoclonal antibody (M05), clone 2D1

Brand: Abnova
Reference: H00083758-M05
Product name: RBP5 monoclonal antibody (M05), clone 2D1
Product description: Mouse monoclonal antibody raised against a full-length recombinant RBP5.
Clone: 2D1
Isotype: IgG2a Kappa
Gene id: 83758
Gene name: RBP5
Gene alias: CRBP-III|CRBP3|CRBPIII
Gene description: retinol binding protein 5, cellular
Genbank accession: NM_031491.1
Immunogen: RBP5 (NP_113679.1, 1 a.a. ~ 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
Protein accession: NP_113679.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083758-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083758-M05-13-15-1.jpg
Application image note: Western Blot analysis of RBP5 expression in transfected 293T cell line by RBP5 monoclonal antibody (M05), clone 2D1.

Lane 1: RBP5 transfected lysate (Predicted MW: 15.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RBP5 monoclonal antibody (M05), clone 2D1 now

Add to cart