SLC25A18 monoclonal antibody (M02), clone 2F12 View larger

SLC25A18 monoclonal antibody (M02), clone 2F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC25A18 monoclonal antibody (M02), clone 2F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC25A18 monoclonal antibody (M02), clone 2F12

Brand: Abnova
Reference: H00083733-M02
Product name: SLC25A18 monoclonal antibody (M02), clone 2F12
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC25A18.
Clone: 2F12
Isotype: IgG2a Kappa
Gene id: 83733
Gene name: SLC25A18
Gene alias: GC2
Gene description: solute carrier family 25 (mitochondrial carrier), member 18
Genbank accession: NM_031481
Immunogen: SLC25A18 (NP_113669, 124 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYR
Protein accession: NP_113669
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083733-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC25A18 monoclonal antibody (M02), clone 2F12 now

Add to cart