Brand: | Abnova |
Reference: | H00083729-M01 |
Product name: | INHBE monoclonal antibody (M01), clone 4B5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant INHBE. |
Clone: | 4B5 |
Isotype: | IgG2a Kappa |
Gene id: | 83729 |
Gene name: | INHBE |
Gene alias: | MGC4638 |
Gene description: | inhibin, beta E |
Genbank accession: | BC005161 |
Immunogen: | INHBE (AAH05161, 21 a.a. ~ 350 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
Protein accession: | AAH05161 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |