INHBE monoclonal antibody (M01), clone 4B5 View larger

INHBE monoclonal antibody (M01), clone 4B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of INHBE monoclonal antibody (M01), clone 4B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about INHBE monoclonal antibody (M01), clone 4B5

Brand: Abnova
Reference: H00083729-M01
Product name: INHBE monoclonal antibody (M01), clone 4B5
Product description: Mouse monoclonal antibody raised against a full-length recombinant INHBE.
Clone: 4B5
Isotype: IgG2a Kappa
Gene id: 83729
Gene name: INHBE
Gene alias: MGC4638
Gene description: inhibin, beta E
Genbank accession: BC005161
Immunogen: INHBE (AAH05161, 21 a.a. ~ 350 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Protein accession: AAH05161
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy INHBE monoclonal antibody (M01), clone 4B5 now

Add to cart