INHBE MaxPab mouse polyclonal antibody (B01) View larger

INHBE MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of INHBE MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about INHBE MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00083729-B01
Product name: INHBE MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human INHBE protein.
Gene id: 83729
Gene name: INHBE
Gene alias: MGC4638
Gene description: inhibin, beta E
Genbank accession: BC005161
Immunogen: INHBE (AAH05161, 21 a.a. ~ 350 a.a) full-length human protein.
Immunogen sequence/protein sequence: GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Protein accession: AAH05161
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083729-B01-13-15-1.jpg
Application image note: Western Blot analysis of INHBE expression in transfected 293T cell line (H00083729-T01) by INHBE MaxPab polyclonal antibody.

Lane 1: INHBE transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy INHBE MaxPab mouse polyclonal antibody (B01) now

Add to cart