Brand: | Abnova |
Reference: | H00083700-M01 |
Product name: | JAM3 monoclonal antibody (M01), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant JAM3. |
Clone: | 1D3 |
Isotype: | IgG2a Kappa |
Gene id: | 83700 |
Gene name: | JAM3 |
Gene alias: | FLJ14529|JAM-C|JAMC |
Gene description: | junctional adhesion molecule 3 |
Genbank accession: | NM_032801 |
Immunogen: | JAM3 (NP_116190, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELT* |
Protein accession: | NP_116190 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged JAM3 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |