JAM3 monoclonal antibody (M01), clone 1D3 View larger

JAM3 monoclonal antibody (M01), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JAM3 monoclonal antibody (M01), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about JAM3 monoclonal antibody (M01), clone 1D3

Brand: Abnova
Reference: H00083700-M01
Product name: JAM3 monoclonal antibody (M01), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant JAM3.
Clone: 1D3
Isotype: IgG2a Kappa
Gene id: 83700
Gene name: JAM3
Gene alias: FLJ14529|JAM-C|JAMC
Gene description: junctional adhesion molecule 3
Genbank accession: NM_032801
Immunogen: JAM3 (NP_116190, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELT*
Protein accession: NP_116190
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083700-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged JAM3 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy JAM3 monoclonal antibody (M01), clone 1D3 now

Add to cart