CALN1 monoclonal antibody (M29), clone 2G5 View larger

CALN1 monoclonal antibody (M29), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CALN1 monoclonal antibody (M29), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CALN1 monoclonal antibody (M29), clone 2G5

Brand: Abnova
Reference: H00083698-M29
Product name: CALN1 monoclonal antibody (M29), clone 2G5
Product description: Mouse monoclonal antibody raised against a partial recombinant CALN1.
Clone: 2G5
Isotype: IgG1 Kappa
Gene id: 83698
Gene name: CALN1
Gene alias: -
Gene description: calneuron 1
Genbank accession: BC020200
Immunogen: CALN1 (AAH20200, 36 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLV
Protein accession: AAH20200
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083698-M29-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083698-M29-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CALN1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CALN1 monoclonal antibody (M29), clone 2G5 now

Add to cart