MS4A8B monoclonal antibody (M04), clone 1B4 View larger

MS4A8B monoclonal antibody (M04), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MS4A8B monoclonal antibody (M04), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about MS4A8B monoclonal antibody (M04), clone 1B4

Brand: Abnova
Reference: H00083661-M04
Product name: MS4A8B monoclonal antibody (M04), clone 1B4
Product description: Mouse monoclonal antibody raised against a full-length recombinant MS4A8B.
Clone: 1B4
Isotype: IgG2a Kappa
Gene id: 83661
Gene name: MS4A8B
Gene alias: 4SPAN4|MS4A4
Gene description: membrane-spanning 4-domains, subfamily A, member 8B
Genbank accession: BC022895
Immunogen: MS4A8B (AAH22895, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
Protein accession: AAH22895
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy MS4A8B monoclonal antibody (M04), clone 1B4 now

Add to cart