Brand: | Abnova |
Reference: | H00083661-M04 |
Product name: | MS4A8B monoclonal antibody (M04), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MS4A8B. |
Clone: | 1B4 |
Isotype: | IgG2a Kappa |
Gene id: | 83661 |
Gene name: | MS4A8B |
Gene alias: | 4SPAN4|MS4A4 |
Gene description: | membrane-spanning 4-domains, subfamily A, member 8B |
Genbank accession: | BC022895 |
Immunogen: | MS4A8B (AAH22895, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK |
Protein accession: | AAH22895 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |