BCL2L12 monoclonal antibody (M01), clone 1B1 View larger

BCL2L12 monoclonal antibody (M01), clone 1B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BCL2L12 monoclonal antibody (M01), clone 1B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about BCL2L12 monoclonal antibody (M01), clone 1B1

Brand: Abnova
Reference: H00083596-M01
Product name: BCL2L12 monoclonal antibody (M01), clone 1B1
Product description: Mouse monoclonal antibody raised against a partial recombinant BCL2L12.
Clone: 1B1
Isotype: IgG1 Kappa
Gene id: 83596
Gene name: BCL2L12
Gene alias: MGC120313|MGC120314|MGC120315
Gene description: BCL2-like 12 (proline rich)
Genbank accession: BC007724
Immunogen: BCL2L12 (AAH07724, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPSPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
Protein accession: AAH07724
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083596-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged BCL2L12 is approximately 10ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BCL2L12 monoclonal antibody (M01), clone 1B1 now

Add to cart