Product successfully added to your shopping cart
Quantity
Total
There are 98 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 38 157,35 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 38 157,35 €
Data sheet of BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about BCL2L12 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00083596-B01P |
| Product name: | BCL2L12 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human BCL2L12 protein. |
| Gene id: | 83596 |
| Gene name: | BCL2L12 |
| Gene alias: | MGC120313|MGC120314|MGC120315 |
| Gene description: | BCL2-like 12 (proline rich) |
| Genbank accession: | NM_001040668 |
| Immunogen: | BCL2L12 (NP_001035758.1, 1 a.a. ~ 333 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPSPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD |
| Protein accession: | NP_001035758.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCL2L12 expression in transfected 293T cell line (H00083596-T01) by BCL2L12 MaxPab polyclonal antibody. Lane 1: BCL2L12 transfected lysate(36.63 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |