RASSF5 monoclonal antibody (M01), clone 5C2 View larger

RASSF5 monoclonal antibody (M01), clone 5C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RASSF5 monoclonal antibody (M01), clone 5C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RASSF5 monoclonal antibody (M01), clone 5C2

Brand: Abnova
Reference: H00083593-M01
Product name: RASSF5 monoclonal antibody (M01), clone 5C2
Product description: Mouse monoclonal antibody raised against a partial recombinant RASSF5.
Clone: 5C2
Isotype: IgG2a Kappa
Gene id: 83593
Gene name: RASSF5
Gene alias: MGC10823|MGC17344|Maxp1|NORE1|NORE1A|NORE1B|RAPL|RASSF3
Gene description: Ras association (RalGDS/AF-6) domain family member 5
Genbank accession: NM_031437
Immunogen: RASSF5 (NP_113625, 100 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTL
Protein accession: NP_113625
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083593-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RASSF5 monoclonal antibody (M01), clone 5C2 now

Add to cart