AKR1CL2 monoclonal antibody (M02), clone 1C8 View larger

AKR1CL2 monoclonal antibody (M02), clone 1C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1CL2 monoclonal antibody (M02), clone 1C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about AKR1CL2 monoclonal antibody (M02), clone 1C8

Brand: Abnova
Reference: H00083592-M02
Product name: AKR1CL2 monoclonal antibody (M02), clone 1C8
Product description: Mouse monoclonal antibody raised against a full-length recombinant AKR1CL2.
Clone: 1C8
Isotype: IgG2a Kappa
Gene id: 83592
Gene name: AKR1CL2
Gene alias: AKRDC1|LoopADR|MGC10612
Gene description: aldo-keto reductase family 1, member C-like 2
Genbank accession: BC002862
Immunogen: AKR1CL2 (AAH02862, 1 a.a. ~ 307 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM
Protein accession: AAH02862
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083592-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083592-M02-13-15-1.jpg
Application image note: Western Blot analysis of AKR1CL2 expression in transfected 293T cell line by AKR1CL2 monoclonal antibody (M02), clone 1C8.

Lane 1: AKR1CL2 transfected lysate (Predicted MW: 34.9 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AKR1CL2 monoclonal antibody (M02), clone 1C8 now

Add to cart