AKR1CL2 purified MaxPab mouse polyclonal antibody (B01P) View larger

AKR1CL2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1CL2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about AKR1CL2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00083592-B01P
Product name: AKR1CL2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human AKR1CL2 protein.
Gene id: 83592
Gene name: AKR1CL2
Gene alias: AKRDC1|LoopADR|MGC10612
Gene description: aldo-keto reductase family 1, member C-like 2
Genbank accession: BC002862.2
Immunogen: AKR1CL2 (AAH02862.1, 1 a.a. ~ 307 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM
Protein accession: AAH02862.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00083592-B01P-13-15-1.jpg
Application image note: Western Blot analysis of AKR1CL2 expression in transfected 293T cell line (H00083592-T01) by AKR1CL2 MaxPab polyclonal antibody.

Lane 1: AKR1CL2 transfected lysate(33.77 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AKR1CL2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart