MFRP monoclonal antibody (M01), clone 1E12 View larger

MFRP monoclonal antibody (M01), clone 1E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFRP monoclonal antibody (M01), clone 1E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MFRP monoclonal antibody (M01), clone 1E12

Brand: Abnova
Reference: H00083552-M01
Product name: MFRP monoclonal antibody (M01), clone 1E12
Product description: Mouse monoclonal antibody raised against a partial recombinant MFRP.
Clone: 1E12
Isotype: IgG2b Lambda
Gene id: 83552
Gene name: MFRP
Gene alias: C1QTNF5|FLJ30570|NNO2|rd6
Gene description: membrane frizzled-related protein
Genbank accession: NM_031433
Immunogen: MFRP (NP_113621, 480 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP
Protein accession: NP_113621
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083552-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083552-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MFRP is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MFRP monoclonal antibody (M01), clone 1E12 now

Add to cart