Brand: | Abnova |
Reference: | H00083452-M01 |
Product name: | RAB33B monoclonal antibody (M01), clone 6F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB33B. |
Clone: | 6F4 |
Isotype: | IgG2a Kappa |
Gene id: | 83452 |
Gene name: | RAB33B |
Gene alias: | DKFZp434G099|MGC138182 |
Gene description: | RAB33B, member RAS oncogene family |
Genbank accession: | NM_031296 |
Immunogen: | RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM |
Protein accession: | NP_112586 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | RAB33B monoclonal antibody (M01), clone 6F4 Western Blot analysis of RAB33B expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Fc gamma receptor IIb participates in maternal IgG trafficking of human placental endothelial cells.Ishikawa T, Takizawa T, Iwaki J, Mishima T, Ui-Tei K, Takeshita T, Matsubara S, Takizawa T Int J Mol Med. 2015 May;35(5):1273-89. doi: 10.3892/ijmm.2015.2141. Epub 2015 Mar 17. |