RAB33B monoclonal antibody (M01), clone 6F4 View larger

RAB33B monoclonal antibody (M01), clone 6F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB33B monoclonal antibody (M01), clone 6F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RAB33B monoclonal antibody (M01), clone 6F4

Brand: Abnova
Reference: H00083452-M01
Product name: RAB33B monoclonal antibody (M01), clone 6F4
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB33B.
Clone: 6F4
Isotype: IgG2a Kappa
Gene id: 83452
Gene name: RAB33B
Gene alias: DKFZp434G099|MGC138182
Gene description: RAB33B, member RAS oncogene family
Genbank accession: NM_031296
Immunogen: RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
Protein accession: NP_112586
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083452-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00083452-M01-1-4-1.jpg
Application image note: RAB33B monoclonal antibody (M01), clone 6F4 Western Blot analysis of RAB33B expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Fc gamma receptor IIb participates in maternal IgG trafficking of human placental endothelial cells.Ishikawa T, Takizawa T, Iwaki J, Mishima T, Ui-Tei K, Takeshita T, Matsubara S, Takizawa T
Int J Mol Med. 2015 May;35(5):1273-89. doi: 10.3892/ijmm.2015.2141. Epub 2015 Mar 17.

Reviews

Buy RAB33B monoclonal antibody (M01), clone 6F4 now

Add to cart