PMFBP1 monoclonal antibody (M01), clone 4G9 View larger

PMFBP1 monoclonal antibody (M01), clone 4G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PMFBP1 monoclonal antibody (M01), clone 4G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about PMFBP1 monoclonal antibody (M01), clone 4G9

Brand: Abnova
Reference: H00083449-M01
Product name: PMFBP1 monoclonal antibody (M01), clone 4G9
Product description: Mouse monoclonal antibody raised against a partial recombinant PMFBP1.
Clone: 4G9
Isotype: IgG2b Kappa
Gene id: 83449
Gene name: PMFBP1
Gene alias: DKFZp434G131|FLJ40146
Gene description: polyamine modulated factor 1 binding protein 1
Genbank accession: NM_031293
Immunogen: PMFBP1 (NP_112583, 99 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FHTEELQTSYYSLRQYQSILEKQTSDLVLLHHHCKLKEDEVILYEEEMGNHNENTGEKLHLAQEQLALAGDKIASLERSLNLYRDKYQSSLSNIELLEC
Protein accession: NP_112583
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083449-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083449-M01-3-38-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PMFBP1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PMFBP1 monoclonal antibody (M01), clone 4G9 now

Add to cart