Brand: | Abnova |
Reference: | H00083440-M01 |
Product name: | ADPGK monoclonal antibody (M01), clone 1E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADPGK. |
Clone: | 1E4 |
Isotype: | IgG2a Kappa |
Gene id: | 83440 |
Gene name: | ADPGK |
Gene alias: | 2610017G09Rik|ADP-GK|DKFZp434B195 |
Gene description: | ADP-dependent glucokinase |
Genbank accession: | NM_031284 |
Immunogen: | ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY |
Protein accession: | NP_112574 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | ADPGK monoclonal antibody (M01), clone 1E4 Western Blot analysis of ADPGK expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Expression and role in glycolysis of human ADP-dependent glucokinase.Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR. Mol Cell Biochem. 2012 Jan 5. [Epub ahead of print] |