ADPGK monoclonal antibody (M01), clone 1E4 View larger

ADPGK monoclonal antibody (M01), clone 1E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADPGK monoclonal antibody (M01), clone 1E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about ADPGK monoclonal antibody (M01), clone 1E4

Brand: Abnova
Reference: H00083440-M01
Product name: ADPGK monoclonal antibody (M01), clone 1E4
Product description: Mouse monoclonal antibody raised against a partial recombinant ADPGK.
Clone: 1E4
Isotype: IgG2a Kappa
Gene id: 83440
Gene name: ADPGK
Gene alias: 2610017G09Rik|ADP-GK|DKFZp434B195
Gene description: ADP-dependent glucokinase
Genbank accession: NM_031284
Immunogen: ADPGK (NP_112574, 425 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Protein accession: NP_112574
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083440-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00083440-M01-1-1-1.jpg
Application image note: ADPGK monoclonal antibody (M01), clone 1E4 Western Blot analysis of ADPGK expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Expression and role in glycolysis of human ADP-dependent glucokinase.Richter S, Richter JP, Mehta SY, Gribble AM, Sutherland-Smith AJ, Stowell KM, Print CG, Ronimus RS, Wilson WR.
Mol Cell Biochem. 2012 Jan 5. [Epub ahead of print]

Reviews

Buy ADPGK monoclonal antibody (M01), clone 1E4 now

Add to cart