ADPGK MaxPab mouse polyclonal antibody (B01) View larger

ADPGK MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADPGK MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about ADPGK MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00083440-B01
Product name: ADPGK MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ADPGK protein.
Gene id: 83440
Gene name: ADPGK
Gene alias: 2610017G09Rik|ADP-GK|DKFZp434B195
Gene description: ADP-dependent glucokinase
Genbank accession: BC006112.1
Immunogen: ADPGK (AAH06112.1, 1 a.a. ~ 497 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY
Protein accession: AAH06112.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083440-B01-13-15-1.jpg
Application image note: Western Blot analysis of ADPGK expression in transfected 293T cell line (H00083440-T01) by ADPGK MaxPab polyclonal antibody.

Lane 1: ADPGK transfected lysate(54.67 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ADPGK MaxPab mouse polyclonal antibody (B01) now

Add to cart