Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TCF7L1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TCF7L1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00083439-A01 |
| Product name: | TCF7L1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TCF7L1. |
| Gene id: | 83439 |
| Gene name: | TCF7L1 |
| Gene alias: | TCF-3|TCF3 |
| Gene description: | transcription factor 7-like 1 (T-cell specific, HMG-box) |
| Genbank accession: | NM_031283 |
| Immunogen: | TCF7L1 (NP_112573, 489 a.a. ~ 586 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKS |
| Protein accession: | NP_112573 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of replicative senescence-associated genes in human umbilical vein endothelial cells by an annealing control primer system.Kim TW, Kim HJ, Lee CH, Kim HY, Baek SH, Kim JH, Kwon KS, Kim JR. Exp Gerontol. 2008 Apr;43(4):286-295. Epub 2008 Jan 10. |