PCDH11Y monoclonal antibody (M02), clone 7D12 View larger

PCDH11Y monoclonal antibody (M02), clone 7D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDH11Y monoclonal antibody (M02), clone 7D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCDH11Y monoclonal antibody (M02), clone 7D12

Brand: Abnova
Reference: H00083259-M02
Product name: PCDH11Y monoclonal antibody (M02), clone 7D12
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDH11Y.
Clone: 7D12
Isotype: IgG2a Kappa
Gene id: 83259
Gene name: PCDH11Y
Gene alias: PCDH-PC|PCDH11X|PCDH22|PCDHY
Gene description: protocadherin 11 Y-linked
Genbank accession: NM_032973
Immunogen: PCDH11Y (NP_004733, 57 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN
Protein accession: NP_004733
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00083259-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00083259-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PCDH11Y is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDH11Y monoclonal antibody (M02), clone 7D12 now

Add to cart