HDHD3 MaxPab mouse polyclonal antibody (B01) View larger

HDHD3 MaxPab mouse polyclonal antibody (B01)

H00081932-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HDHD3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about HDHD3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00081932-B01
Product name: HDHD3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HDHD3 protein.
Gene id: 81932
Gene name: HDHD3
Gene alias: 2810435D12Rik|C9orf158|MGC12904
Gene description: haloacid dehalogenase-like hydrolase domain containing 3
Genbank accession: NM_031219
Immunogen: HDHD3 (NP_112496, 1 a.a. ~ 251 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL
Protein accession: NP_112496
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081932-B01-13-15-1.jpg
Application image note: Western Blot analysis of HDHD3 expression in transfected 293T cell line (H00081932-T01) by HDHD3 MaxPab polyclonal antibody.

Lane 1: HDHD3 transfected lysate(27.61 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HDHD3 MaxPab mouse polyclonal antibody (B01) now

Add to cart