RAB1B monoclonal antibody (M02), clone 1B2 View larger

RAB1B monoclonal antibody (M02), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB1B monoclonal antibody (M02), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about RAB1B monoclonal antibody (M02), clone 1B2

Brand: Abnova
Reference: H00081876-M02
Product name: RAB1B monoclonal antibody (M02), clone 1B2
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB1B.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 81876
Gene name: RAB1B
Gene alias: -
Gene description: RAB1B, member RAS oncogene family
Genbank accession: NM_030981
Immunogen: RAB1B (NP_112243, 91 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Protein accession: NP_112243
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081876-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081876-M02-1-4-1.jpg
Application image note: RAB1B monoclonal antibody (M02), clone 1B2. Western Blot analysis of RAB1B expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB1B monoclonal antibody (M02), clone 1B2 now

Add to cart