Brand: | Abnova |
Reference: | H00081856-M04 |
Product name: | ZNF611 monoclonal antibody (M04), clone 4F1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ZNF611. |
Clone: | 4F1 |
Isotype: | IgG2b Kappa |
Gene id: | 81856 |
Gene name: | ZNF611 |
Gene alias: | MGC5384 |
Gene description: | zinc finger protein 611 |
Genbank accession: | BC000918 |
Immunogen: | ZNF611 (AAH00918, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLQRLQIIGESIMKRDLTSVINVANFSEIVHILQVIGELILERNLTNVMTVPRSSVKLHPMQNIGEFIQERNLTSVMIVAKPLLHVHTSLDIRESILDRNLTNVISVARSSVQDHSMQNIRKFIFEITVPNEMSIANHQALIDIGVNSALT |
Protein accession: | AAH00918 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNF611 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |