ZNF611 monoclonal antibody (M04), clone 4F1 View larger

ZNF611 monoclonal antibody (M04), clone 4F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF611 monoclonal antibody (M04), clone 4F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about ZNF611 monoclonal antibody (M04), clone 4F1

Brand: Abnova
Reference: H00081856-M04
Product name: ZNF611 monoclonal antibody (M04), clone 4F1
Product description: Mouse monoclonal antibody raised against a full length recombinant ZNF611.
Clone: 4F1
Isotype: IgG2b Kappa
Gene id: 81856
Gene name: ZNF611
Gene alias: MGC5384
Gene description: zinc finger protein 611
Genbank accession: BC000918
Immunogen: ZNF611 (AAH00918, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLQRLQIIGESIMKRDLTSVINVANFSEIVHILQVIGELILERNLTNVMTVPRSSVKLHPMQNIGEFIQERNLTSVMIVAKPLLHVHTSLDIRESILDRNLTNVISVARSSVQDHSMQNIRKFIFEITVPNEMSIANHQALIDIGVNSALT
Protein accession: AAH00918
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081856-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNF611 is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ZNF611 monoclonal antibody (M04), clone 4F1 now

Add to cart