SFXN3 monoclonal antibody (M01), clone 4A3 View larger

SFXN3 monoclonal antibody (M01), clone 4A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFXN3 monoclonal antibody (M01), clone 4A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SFXN3 monoclonal antibody (M01), clone 4A3

Brand: Abnova
Reference: H00081855-M01
Product name: SFXN3 monoclonal antibody (M01), clone 4A3
Product description: Mouse monoclonal antibody raised against a partial recombinant SFXN3.
Clone: 4A3
Isotype: IgG2b Kappa
Gene id: 81855
Gene name: SFXN3
Gene alias: BA108L7.2|SFX3
Gene description: sideroflexin 3
Genbank accession: BC000124
Immunogen: SFXN3 (AAH00124.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQV
Protein accession: AAH00124.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081855-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081855-M01-1-25-1.jpg
Application image note: SFXN3 monoclonal antibody (M01), clone 4A3. Western Blot analysis of SFXN3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFXN3 monoclonal antibody (M01), clone 4A3 now

Add to cart