Brand: | Abnova |
Reference: | H00081855-M01 |
Product name: | SFXN3 monoclonal antibody (M01), clone 4A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SFXN3. |
Clone: | 4A3 |
Isotype: | IgG2b Kappa |
Gene id: | 81855 |
Gene name: | SFXN3 |
Gene alias: | BA108L7.2|SFX3 |
Gene description: | sideroflexin 3 |
Genbank accession: | BC000124 |
Immunogen: | SFXN3 (AAH00124.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQV |
Protein accession: | AAH00124.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SFXN3 monoclonal antibody (M01), clone 4A3. Western Blot analysis of SFXN3 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |