SFXN3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

SFXN3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFXN3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about SFXN3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00081855-D01P
Product name: SFXN3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human SFXN3 protein.
Gene id: 81855
Gene name: SFXN3
Gene alias: BA108L7.2|SFX3
Gene description: sideroflexin 3
Genbank accession: NM_030971.3
Immunogen: SFXN3 (NP_112233.2, 1 a.a. ~ 325 a.a) full-length human protein.
Immunogen sequence/protein sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVADEAGQRLGYSVTAAKQGIFQVVISRICMAIPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQKSSIHISNLEPELRAQIHEQNPSVEVVYYNKGL
Protein accession: NP_112233.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00081855-D01P-13-15-1.jpg
Application image note: Western Blot analysis of SFXN3 expression in transfected 293T cell line (H00081855-T01) by SFXN3 MaxPab polyclonal antibody.

Lane 1: SFXN3 transfected lysate(36.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFXN3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart