TRIM56 monoclonal antibody (M01), clone 4C5 View larger

TRIM56 monoclonal antibody (M01), clone 4C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM56 monoclonal antibody (M01), clone 4C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about TRIM56 monoclonal antibody (M01), clone 4C5

Brand: Abnova
Reference: H00081844-M01
Product name: TRIM56 monoclonal antibody (M01), clone 4C5
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM56.
Clone: 4C5
Isotype: IgG2a Kappa
Gene id: 81844
Gene name: TRIM56
Gene alias: DKFZp667O116|FLJ35608|RNF109
Gene description: tripartite motif-containing 56
Genbank accession: NM_030961
Immunogen: TRIM56 (NP_112223, 656 a.a. ~ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NSVVICDGLGQVVGEYKGPGLHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS
Protein accession: NP_112223
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081844-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081844-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TRIM56 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRIM56 monoclonal antibody (M01), clone 4C5 now

Add to cart