NETO2 monoclonal antibody (M02), clone 3E3 View larger

NETO2 monoclonal antibody (M02), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NETO2 monoclonal antibody (M02), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NETO2 monoclonal antibody (M02), clone 3E3

Brand: Abnova
Reference: H00081831-M02
Product name: NETO2 monoclonal antibody (M02), clone 3E3
Product description: Mouse monoclonal antibody raised against a partial recombinant NETO2.
Clone: 3E3
Isotype: IgG2a Kappa
Gene id: 81831
Gene name: NETO2
Gene alias: FLJ10430|FLJ14724|FLJ90456|NEOT2
Gene description: neuropilin (NRP) and tolloid (TLL)-like 2
Genbank accession: NM_018092
Immunogen: NETO2 (NP_060562.3, 426 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Protein accession: NP_060562.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081831-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081831-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged NETO2 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NETO2 monoclonal antibody (M02), clone 3E3 now

Add to cart