No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00081831-D01P |
Product name: | NETO2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NETO2 protein. |
Gene id: | 81831 |
Gene name: | NETO2 |
Gene alias: | FLJ10430|FLJ14724|FLJ90456|NEOT2 |
Gene description: | neuropilin (NRP) and tolloid (TLL)-like 2 |
Genbank accession: | BC012381.1 |
Immunogen: | NETO2 (AAH12381.1, 1 a.a. ~ 148 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF |
Protein accession: | AAH12381.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | NETO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NETO2 expression in human liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |