TLR10 monoclonal antibody (M01), clone 2A11 View larger

TLR10 monoclonal antibody (M01), clone 2A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR10 monoclonal antibody (M01), clone 2A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TLR10 monoclonal antibody (M01), clone 2A11

Brand: Abnova
Reference: H00081793-M01
Product name: TLR10 monoclonal antibody (M01), clone 2A11
Product description: Mouse monoclonal antibody raised against a full length recombinant TLR10.
Clone: 2A11
Isotype: IgG1 Kappa
Gene id: 81793
Gene name: TLR10
Gene alias: CD290|MGC104967|MGC126398|MGC126399
Gene description: toll-like receptor 10
Genbank accession: N/A
Immunogen: TLR10 (NP_112218.2, 1 a.a. ~ 811 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF
Protein accession: NP_112218.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081793-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (87.27 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00081793-M01-1-11-1.jpg
Application image note: TLR10 monoclonal antibody (M01), clone 2A11 Western Blot analysis of TLR10 expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TLR10 monoclonal antibody (M01), clone 2A11 now

Add to cart