RNF170 monoclonal antibody (M01), clone 2D6 View larger

RNF170 monoclonal antibody (M01), clone 2D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF170 monoclonal antibody (M01), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RNF170 monoclonal antibody (M01), clone 2D6

Brand: Abnova
Reference: H00081790-M01
Product name: RNF170 monoclonal antibody (M01), clone 2D6
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF170.
Clone: 2D6
Isotype: IgG2b Kappa
Gene id: 81790
Gene name: RNF170
Gene alias: DKFZp564A022|FLJ38306
Gene description: ring finger protein 170
Genbank accession: NM_030954
Immunogen: RNF170 (NP_112216, 121 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGG
Protein accession: NP_112216
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081790-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081790-M01-1-6-1.jpg
Application image note: RNF170 monoclonal antibody (M01), clone 2D6. Western Blot analysis of RNF170 expression in Jurkat(Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF170 monoclonal antibody (M01), clone 2D6 now

Add to cart