Brand: | Abnova |
Reference: | H00081790-M01 |
Product name: | RNF170 monoclonal antibody (M01), clone 2D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF170. |
Clone: | 2D6 |
Isotype: | IgG2b Kappa |
Gene id: | 81790 |
Gene name: | RNF170 |
Gene alias: | DKFZp564A022|FLJ38306 |
Gene description: | ring finger protein 170 |
Genbank accession: | NM_030954 |
Immunogen: | RNF170 (NP_112216, 121 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGG |
Protein accession: | NP_112216 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RNF170 monoclonal antibody (M01), clone 2D6. Western Blot analysis of RNF170 expression in Jurkat(Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |