Brand: | Abnova |
Reference: | H00081788-M04 |
Product name: | NUAK2 monoclonal antibody (M04), clone 2F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUAK2. |
Clone: | 2F9 |
Isotype: | IgG2a Kappa |
Gene id: | 81788 |
Gene name: | NUAK2 |
Gene alias: | DKFZp434J037|DKFZp686F01113|FLJ90349|SNARK |
Gene description: | NUAK family, SNF1-like kinase, 2 |
Genbank accession: | NM_030952 |
Immunogen: | NUAK2 (NP_112214.1, 521 a.a. ~ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT |
Protein accession: | NP_112214.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NUAK2 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |