NUAK2 monoclonal antibody (M04), clone 2F9 View larger

NUAK2 monoclonal antibody (M04), clone 2F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUAK2 monoclonal antibody (M04), clone 2F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about NUAK2 monoclonal antibody (M04), clone 2F9

Brand: Abnova
Reference: H00081788-M04
Product name: NUAK2 monoclonal antibody (M04), clone 2F9
Product description: Mouse monoclonal antibody raised against a partial recombinant NUAK2.
Clone: 2F9
Isotype: IgG2a Kappa
Gene id: 81788
Gene name: NUAK2
Gene alias: DKFZp434J037|DKFZp686F01113|FLJ90349|SNARK
Gene description: NUAK family, SNF1-like kinase, 2
Genbank accession: NM_030952
Immunogen: NUAK2 (NP_112214.1, 521 a.a. ~ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Protein accession: NP_112214.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081788-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081788-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NUAK2 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NUAK2 monoclonal antibody (M04), clone 2F9 now

Add to cart