ISCA1 monoclonal antibody (M02), clone 1A11 View larger

ISCA1 monoclonal antibody (M02), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ISCA1 monoclonal antibody (M02), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ISCA1 monoclonal antibody (M02), clone 1A11

Brand: Abnova
Reference: H00081689-M02
Product name: ISCA1 monoclonal antibody (M02), clone 1A11
Product description: Mouse monoclonal antibody raised against a full-length recombinant ISCA1.
Clone: 1A11
Isotype: IgG2a Lambda
Gene id: 81689
Gene name: ISCA1
Gene alias: HBLD2|ISA1|MGC4276|RP11-507D14.2|hIscA
Gene description: iron-sulfur cluster assembly 1 homolog (S. cerevisiae)
Genbank accession: BC002675
Immunogen: ISCA1 (AAH02675, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
Protein accession: AAH02675
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081689-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.93 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081689-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ISCA1 is 0.3 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ISCA1 monoclonal antibody (M02), clone 1A11 now

Add to cart