Brand: | Abnova |
Reference: | H00081631-M02 |
Product name: | MAP1LC3B monoclonal antibody (M02), clone 4G7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MAP1LC3B. |
Clone: | 4G7 |
Isotype: | IgG2a Kappa |
Gene id: | 81631 |
Gene name: | MAP1LC3B |
Gene alias: | LC3B|MAP1A/1BLC3 |
Gene description: | microtubule-associated protein 1 light chain 3 beta |
Genbank accession: | BC018634 |
Immunogen: | MAP1LC3B (AAH18634, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
Protein accession: | AAH18634 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MAP1LC3B is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Bacteroides fragilis Enterotoxin Induces the Formation of Autophagosomes in Endothelial Cells but Interferes Their Autophagosomal Fusion with Lysosomes for Complete Autophagic Flux Through a Mitogen-Activated Protein Kinase, AP-1, and C/EBP Homologous Protein-Dependent Pathway.Ko SH, Jeon JI, Myung HS, Kim YJ, Kim JM. Infect Immun. 2017 Jul 10. [Epub ahead of print] |