MAP1LC3B monoclonal antibody (M02), clone 4G7 View larger

MAP1LC3B monoclonal antibody (M02), clone 4G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP1LC3B monoclonal antibody (M02), clone 4G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MAP1LC3B monoclonal antibody (M02), clone 4G7

Brand: Abnova
Reference: H00081631-M02
Product name: MAP1LC3B monoclonal antibody (M02), clone 4G7
Product description: Mouse monoclonal antibody raised against a full-length recombinant MAP1LC3B.
Clone: 4G7
Isotype: IgG2a Kappa
Gene id: 81631
Gene name: MAP1LC3B
Gene alias: LC3B|MAP1A/1BLC3
Gene description: microtubule-associated protein 1 light chain 3 beta
Genbank accession: BC018634
Immunogen: MAP1LC3B (AAH18634, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Protein accession: AAH18634
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081631-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.49 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081631-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MAP1LC3B is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Bacteroides fragilis Enterotoxin Induces the Formation of Autophagosomes in Endothelial Cells but Interferes Their Autophagosomal Fusion with Lysosomes for Complete Autophagic Flux Through a Mitogen-Activated Protein Kinase, AP-1, and C/EBP Homologous Protein-Dependent Pathway.Ko SH, Jeon JI, Myung HS, Kim YJ, Kim JM.
Infect Immun. 2017 Jul 10. [Epub ahead of print]

Reviews

Buy MAP1LC3B monoclonal antibody (M02), clone 4G7 now

Add to cart